TA331027 METTL10 antibody

Rabbit polyclonal Anti-METTL10 Antibody

See related secondary antibodies

Search for all "METTL10"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human METTL10

Product Description for METTL10

Rabbit anti Human METTL10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for METTL10

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms C10orf138, Methyltransferase-like protein 10
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5JPI9
Immunogen:
The immunogen for anti-METTL10 antibody: synthetic peptide directed towards the N terminal of human LOC399818. Synthetic peptide located within the following region: SSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFRE.
GeneID:
399818
Application WB
Background LOC399818 belongs to the methyltransferase superfamily
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for METTL10 (2 products)

Catalog No. Species Pres. Purity   Source  

METTL10

METTL10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

METTL10

METTL10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for METTL10 (1 products)

Catalog No. Species Pres. Purity   Source  

LOC399818 293T Cell Transient Overexpression Lysate(Denatured)

LOC399818 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn