H00079091-B01P METTL22 antibody

See related secondary antibodies

Search for all "METTL22"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human METTL22

H00079091-B01P

Product Description for METTL22

Mouse anti Human METTL22.
Product is tested for Western blot / Immunoblot.

Properties for METTL22

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C16orf68, LP8272
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BUU2
Immunogen:
METTL22 (AAH01908.1, 1 a.a. ~ 205 a.a) full-length human protein.
AA Sequence:
MVQLAPAAAMDEVTFRSDTVLSDVHLYTPNHRHLMVRLNSVGQPVFLSQFKLLWSQDSWTDSGAKGGSHRDVHTKE PPSAETGSTGSPPGSGHGNEGFSLQAGTDTTGQEVAEAQLDEDGDLDVVRRPRAASDSNPAGPLRDKVHPMILAQE EDDVLGEEAQGSPHDIIRIGVAGRPAPGRLHPVPTGPLPRMYSAGARGRHGAR
GeneID:
79091
Add. information Mouse polyclonal antibody raised against a full-length human METTL22 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for METTL22 (1 products)

Catalog No. Species Pres. Purity   Source  

METTL22 overexpression lysate

METTL22 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn