discontinued

NBP1-55180 METTL7B antibody

See related secondary antibodies

Search for all "METTL7B"

50 µg / €390.00

Quick Overview

Rabbit anti Human METTL7B

Product Description for METTL7B

Rabbit anti Human METTL7B.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for METTL7B

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A8K247
Immunogen:
Synthetic peptides corresponding to METTL7B(methyltransferase like 7B) The peptide sequence was selected from the middle region of METTL7B. Peptide sequence FVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLF.
GeneID:
196410
Background METTL7B belongs to the methyltransferase superfamily. It is a probable methyltransferase.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 196410

Accessory Products

  • LinkedIn