H00079828-B01P METTL8 antibody

See related secondary antibodies

Search for all "METTL8"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human METTL8

H00079828-B01P

Product Description for METTL8

Mouse anti Human METTL8.
Product is tested for Western blot / Immunoblot.

Properties for METTL8

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ13334, FLJ13984, FLJ31054, FLJ42098, FLJ77788, TIP
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A8K7U3
Immunogen:
METTL8 (NP_079046.1, 1 a.a. ~ 241 a.a) full-length human protein.
AA Sequence:
MQWSKEEEAAARKKVKENSAVRVLLEEQVKYEREASKYWDTFYKIHKNKFFKDRNWLLREFPEILPVDQKPEEKAR ESSWDHVKTSATNRFSRMHCPTVPDEKNHYEKSSGSSEGQSKTESDFSNLDSEKHKKGPMETGLFPGSNATFRILE VGCGAGNSVFPILNTLENSPESFLYCCDFASGAVELVKSHSSYRATQCFAFVHDVCDDGLPYPFPDGILDVILLVF VLSSIHPDRTLFI
GeneID:
79828
Add. information Mouse polyclonal antibody raised against a full-length human METTL8 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn