H00113691-B01P MGC16703 antibody

See related secondary antibodies

Search for all "MGC16703"

50 µg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human MGC16703

Product Description for MGC16703

Mouse anti Human MGC16703.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for MGC16703

Product Category Primary Antibodies
Quantity 50 µg
Synonyms -, alpha tubulin-like
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
D3DX41
Immunogen:
MGC16703 (NP_659479, 1 a.a. ~ 154 a.a) full-length human protein.
AA Sequence:
MQLSGNGLEEQAAQHLDELLLAHTDLKSLDLSYNQLNDQADLCMGLQGFLIFHSFGGGTGSGFVSLLMKRLSVDYG KKSKLEFAICPAPQVSMAMTEPYNSILTTYTTLEHSDCAFIVNSKATYDMSAQPGHRVSHVHQPQSSGQIVSSITA SL
Remarks:
Gene Accession: NM_145042
Add. information Mouse polyclonal antibody raised against a full-length human MGC16703 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for MGC16703 (2 products)

Catalog No. Species Pres. Purity   Source  

MGC16703

MGC16703 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
10 µg / €380.00
  Abnova Taiwan Corp.

MGC16703

MGC16703 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
25 µg / €510.00
  Abnova Taiwan Corp.
  • LinkedIn