discontinued

H00113691-B01P MGC16703 antibody

See related secondary antibodies

Search for all "MGC16703"

Quick Overview

Mouse anti Human MGC16703

Product Description for MGC16703

Mouse anti Human MGC16703.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for MGC16703

Product Category Primary Antibodies
Quantity 50 µg
Synonyms -, alpha tubulin-like
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
D3DX41
Immunogen:
MGC16703 (NP_659479, 1 a.a. ~ 154 a.a) full-length human protein.
AA Sequence:
MQLSGNGLEEQAAQHLDELLLAHTDLKSLDLSYNQLNDQADLCMGLQGFLIFHSFGGGTGSGFVSLLMKRLSVDYG KKSKLEFAICPAPQVSMAMTEPYNSILTTYTTLEHSDCAFIVNSKATYDMSAQPGHRVSHVHQPQSSGQIVSSITA SL
Remarks:
Gene Accession: NM_145042
Add. information Mouse polyclonal antibody raised against a full-length human MGC16703 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for MGC16703 (2 products)

Catalog No. Species Pres. Purity   Source  

MGC16703

MGC16703 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MGC16703

MGC16703 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn