H00206426-B01P MGC26597 antibody

See related secondary antibodies

Search for all "MGC26597"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human MGC26597

H00206426-B01P

Product Description for MGC26597

Mouse anti Human MGC26597.
Product is tested for Western blot / Immunoblot.

Properties for MGC26597

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms -
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
MGC26597 (AAH28580.1, 1 a.a. ~ 512 a.a) full-length human protein.
AA Sequence:
MASASSQPSLAVGFSSFDPGAPSCTASSASGILSPTASEVPYASGMPIKKTGHRGVDSSGETTYKKTTSTALKGAI QLGITYTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNAFRFKTYAPVAFRYFRELFGIPPDDYLCSL CSEPLIELCSSGASGSLFYVSSDDELIIKTLQHKEAEFLQKLLPGYYLNLSQNPRTLLPKFFGLYCVQTGGKNIRI VVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADTYNALCKTLQRDCLVLQS FKIMDYSLWLSIHNIDHAQREPLSSDTLQVSIDTQRLAPQKALYSTAMEFIQGEARLGDTMEADDHMGGIPAQNSK GERLLLYIGIIDILQSYTFLKKLEHSWKAVVHDGDAVSVHRPGFYAERFQHFMCNAVFKKIPLKPSPSKKFRSGLS FSLHTGSSGNSCITYQPLVSEEHKSQVIKVQVEPGVHLGRSDVLPQTSESTFGGNQ
GeneID:
206426
Add. information Mouse polyclonal antibody raised against a full-length human MGC26597 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn