discontinued

H00079014-B01 MGC3020 antibody

See related secondary antibodies

Search for all "MGC3020"

50 µl / €370.00

Quick Overview

Mouse anti Human MGC3020

H00079014-B01

More Views

  • H00079014-B01

Product Description for MGC3020

Mouse anti Human MGC3020.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for MGC3020

Product Category Primary Antibodies
Quantity 50 µl
Synonyms -, MaxPab, hypothetical protein MGC3020
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
MGC3020 (AAH00552, 1 a.a. ~ 148 a.a) full-length human protein.
AA Sequence:
MFLNGNCLETLKKKEPEGGRRRLSHPRNMGWMRPSQETTPPDRSHHSGFGLFCGDPGPEIEPLSLWVFPQEMVLEI HQLFMDHEYPCHHITSHCTWVAAHWTTSQSCAAWQGCRRVCCSTWWKSPAQCTRPTVMSATFETAQEPGPS*
Remarks:
Gene Accession: BC000552
Add. information Mouse polyclonal antibody raised against a full-length human MGC3020 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Serum
Specificity
Species:
Human

Accessory Products

  • LinkedIn