H00399670-B01 MGC34774 antibody

See related secondary antibodies

Search for all "MGC34774"

50 µl / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human MGC34774

Product Description for MGC34774

Mouse anti Human MGC34774.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for MGC34774

Product Category Primary Antibodies
Quantity 50 µl
Synonyms -, ribosomal protein L13A-like
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
MGC34774 (NP_976053, 1 a.a. ~ 170 a.a) full-length human protein.
AA Sequence:
MNSVSVVMMLTSKPLHILGRFITKPLLFTNSMENFELTPSRHGRVHHQSCHEAPRTYKVAAEDSRKTEPGAQWPRP SCGPPGSHLGQVGSAGKETGGRAPRGHQHFWQFLEKQIKVSGLPLQADEHQPFPRPARPAIPGPPAHLLVALQNQV GPGCPGPPYGVLWDLTAL
Remarks:
Gene Accession: NM_203308
Add. information Mouse polyclonal antibody raised against a full-length human MGC34774 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn