discontinued

TA333324 MGC50722 antibody

Rabbit Polyclonal Anti-MGC50722 Antibody

See related secondary antibodies

Search for all "MGC50722"

Quick Overview

Rabbit anti Human MGC50722

Product Description for MGC50722

Rabbit anti Human MGC50722.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MGC50722

Product Category Primary Antibodies
Quantity 50 µg
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IVT4
Immunogen:
The immunogen for Anti-MGC50722 Antibody: synthetic peptide directed towards the N terminal of human MGC50722. Synthetic peptide located within the following region: DPPWAAPHVVGSDDLKEPGPWGKACSLPMWSTGPEARDGDSSVSSGRLSC.
GeneID:
399693
Application WB
Background The specific function of the protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn