TA333324 MGC50722 antibody

Rabbit Polyclonal Anti-MGC50722 Antibody

See related secondary antibodies

Search for all "MGC50722"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MGC50722

Product Description for MGC50722

Rabbit anti Human MGC50722.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MGC50722

Product Category Primary Antibodies
Quantity 50 µg
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-MGC50722 Antibody: synthetic peptide directed towards the N terminal of human MGC50722. Synthetic peptide located within the following region: DPPWAAPHVVGSDDLKEPGPWGKACSLPMWSTGPEARDGDSSVSSGRLSC.
Application WB
Background The specific function of the protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn