discontinued

H00124221-B01P MGC52282 antibody

See related secondary antibodies

Search for all "MGC52282"

Quick Overview

Mouse anti Human MGC52282

Product Description for MGC52282

Mouse anti Human MGC52282.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for MGC52282

Product Category Primary Antibodies
Quantity 50 µg
Synonyms PRSS30P
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
MGC52282 (AAH41609, 1 a.a. ~ 146 a.a) full-length human protein.
AA Sequence:
MRPLQGGREDCGRPRHPGRTLAVAGWPVVDLSGACMWGLPHPPTLGAHSRPLLPEGDSGGPLVCPINDTWIQAGIV SWGFGCARPFRPGVYTQVLSYTDWIQRTLAESHSGMSGARPGAPGSHSGTSRSHPVLLLELLTVCLLGSL
Remarks:
Gene Accession: BC041609
Add. information Mouse polyclonal antibody raised against a full-length human MGC52282 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn