H00124221-B01P MGC52282 antibody

See related secondary antibodies

Search for all "MGC52282"

50 µg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human MGC52282

Product Description for MGC52282

Mouse anti Human MGC52282.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for MGC52282

Product Category Primary Antibodies
Quantity 50 µg
Synonyms PRSS30P
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
MGC52282 (AAH41609, 1 a.a. ~ 146 a.a) full-length human protein.
AA Sequence:
MRPLQGGREDCGRPRHPGRTLAVAGWPVVDLSGACMWGLPHPPTLGAHSRPLLPEGDSGGPLVCPINDTWIQAGIV SWGFGCARPFRPGVYTQVLSYTDWIQRTLAESHSGMSGARPGAPGSHSGTSRSHPVLLLELLTVCLLGSL
Remarks:
Gene Accession: BC041609
Add. information Mouse polyclonal antibody raised against a full-length human MGC52282 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn