discontinued

H00403340-B01 MGC70870 antibody

See related secondary antibodies

Search for all "MGC70870"

Quick Overview

Mouse anti Human MGC70870

Product Description for MGC70870

Mouse anti Human MGC70870.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for MGC70870

Product Category Primary Antibodies
Quantity 50 µl
Synonyms -, hypothetical LOC403340
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
MGC70870 (NP_982348, 1 a.a. ~ 149 a.a) full-length human protein.
AA Sequence:
MQEIHEKVLNEVVGAMMYHNFSLTREDLENFKALRVIMQVGSGYDNVAIKAAGELEIALCSIPSAAVEETADSTTG HILNLYWGNRSLYQALREGTRVHSVEQIGEVASVKARIRGEILGLIGFGRTQQEVAVRAKAFAGWDRAVPGCA
Remarks:
Gene Accession: NM_203481
Add. information Mouse polyclonal antibody raised against a full-length human MGC70870 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn