discontinued

NBP1-59185 MICA antibody

See related secondary antibodies

Search for all "MICA"

0.1 mg / €360.00

Quick Overview

Rabbit anti Human MICA

Product Description for MICA

Rabbit anti Human MICA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MICA

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms MGC111087, PERB11.1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96QC4
Immunogen:
Synthetic peptides corresponding to MICA(MHC class I polypeptide-related sequence A) The peptide sequence was selected from the middle region of MICA. Peptide sequence LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDT.
GeneID:
100507436
Background MICA is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells.MICA encodes the higly polymorphic MHC (HLA) class I chain-related gene A. The protein product is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified
Gene ID 4276

Accessory Products

Proteins and/or Positive Controls

Proteins for MICA (1 products)

Catalog No. Species Pres. Purity   Source  

MHC class I polypeptide-related sequence A (MICA), transcript variant 1 (allele MICA*00801).

MHC class I polypeptide-related sequence A (MICA), transcript variant 1 (allele MICA*00801). Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn