NBP1-94001 MICALCL antibody

See related secondary antibodies

Search for all "MICALCL"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MICALCL

Product Description for MICALCL

Rabbit anti Human MICALCL.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for MICALCL

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZW33
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: IRRSLEPLLSNSEGGKKAWAKQESKTLPTQACTRSFSLRKTNSNKDGDQHSPGRNQSSAFSPPDPALRTHSLPNRPSKVFPALRSPPCSKIEDVPTLL
GeneID:
84953
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 84953

Accessory Products

Proteins and/or Positive Controls

Proteins for MICALCL (1 products)

Catalog No. Species Pres. Purity   Source  

MICAL C-terminal like (MICALCL)

MICAL C-terminal like (MICALCL) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for MICALCL (1 products)

Catalog No. Species Pres. Purity   Source  

MICALCL overexpression lysate

MICALCL overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn