discontinued

NBP1-74100 MID2 antibody

See related secondary antibodies

Search for all "MID2"

50 µg / €390.00

Quick Overview

Rabbit anti Mouse MID2

NBP1-74100

Product Description for MID2

Rabbit anti Mouse MID2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for MID2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B1AVF4
Immunogen:
Synthetic peptides corresponding to the N terminal of Mid2. Immunizing peptide sequence ASLNDRFEKLKQTLEMNLTNLVKRNSELENQMAKLIQICQQVEVNTAMHE.
GeneID:
23947
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
State:
Aff - Purified
Gene ID 23947

Accessory Products

  • LinkedIn