H00057409-B01P MIF4GD antibody

See related secondary antibodies

Search for all "MIF4GD"

50 µg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human MIF4GD

H00057409-B01P

Product Description for MIF4GD

Mouse anti Human MIF4GD.
Product is tested for Western blot / Immunoblot.

Properties for MIF4GD

Product Category Primary Antibodies
Quantity 50 µg
Synonyms AD023, MGC45027, MIFD, SLIP1
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N4Q5
Immunogen:
MIF4GD (NP_065730.2, 1 a.a. ~ 256 a.a) full-length human protein.
AA Sequence:
MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYRDPGAVDLEKVANVIV DHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVN NMPMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLL LLEIIEFRAAGWKTTPAAHKYYYSEVSD
GeneID:
57409
Add. information Mouse polyclonal antibody raised against a full-length human MIF4GD protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.4.
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn