discontinued

AP42063PU-N MKX antibody

See related secondary antibodies

Search for all "MKX"

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog MKX

Product Description for MKX

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog MKX.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for MKX

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms C10orf48, Homeobox protein Mohawk, IRXL1
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Can, Chk, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Acris Antibodies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IYA7
Immunogen:
The immunogen for anti-MKX antibody: synthetic peptide directed towards the middle region of human MKX.
AA Sequence:
KYKSSLLNRYLNDSLRHVMATNTTMMGKTRQRNHSGSFSSNEFEEELVSP
GeneID:
283078
Application Western blotting (0.2 - 1 µg/ml)
Background MKX is a member of the TALE superclass of atypical homeobox genes that is most closely related to the Iroquois class. It may act as a morphogenetic regulator of cell adhesion.
General Readings Anderson,D.M., (2006) Dev. Dyn. 235 (3), 792-801
Storage Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term. Avoid repeated freezing and thawing. Shelf life: one year from despatch.
Format
Purification:
Purified on peptide immunoaffinity column
State:
Lyophilised from PBS
Aff - Purified
Reconstitution:
Add 50 μl of distilled water
Species Reactivity
Species reactivity (expected):
Dog, Mouse, Rat, Bovine, African clawed frog, Chicken, Zebrafish
Species reactivity (tested):
Human
Gene ID 283078

Accessory Products

Proteins and/or Positive Controls

Proteins for MKX (5 products)

Catalog No. Species Pres. Purity   Source  

MKX (full length, N-term HIS tag)

MKX Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

MKX

MKX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MKX

MKX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MKX

MKX Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MKX

MKX Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MKX (2 products)

Catalog No. Species Pres. Purity   Source  

MKX overexpression lysate

MKX overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Mohawk homeobox Lysate

Western Blot: Mohawk homeobox Lysate [NBL1-13129] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MKX
  Novus Biologicals Inc.
  • LinkedIn