NBP1-90652 MMGT1 antibody

See related secondary antibodies

Search for all "MMGT1"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MMGT1

Product Description for MMGT1

Rabbit anti Human MMGT1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for MMGT1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N4V1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKL
GeneID:
93380
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 93380

Accessory Products

Proteins and/or Positive Controls

Proteins for MMGT1 (1 products)

Catalog No. Species Pres. Purity   Source  

Membrane magnesium transporter 1 (MMGT1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug (full length, N-term HIS tag)

Membrane magnesium transporter 1 (MMGT1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.
  • LinkedIn