discontinued

NBP1-90652 MMGT1 antibody

See related secondary antibodies

Search for all "MMGT1"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human MMGT1

Product Description for MMGT1

Rabbit anti Human MMGT1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for MMGT1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N4V1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKL
GeneID:
93380
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 93380

Accessory Products

Proteins and/or Positive Controls

Proteins for MMGT1 (1 products)

Catalog No. Species Pres. Purity   Source  

Membrane magnesium transporter 1 (MMGT1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug (full length, N-term HIS tag)

Membrane magnesium transporter 1 (MMGT1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.
  • LinkedIn