TA344866 MNS1 antibody

Rabbit Polyclonal Anti-MNS1 Antibody - N-terminal region

See related secondary antibodies

Search for all "MNS1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MNS1

Product Description for MNS1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MNS1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MNS1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Meiosis-specific nuclear structural protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-MNS1 antibody: synthetic peptide directed towards the N terminal of human MNS1. Synthetic peptide located within the following region: EKLAMELAKLKHESLKDEKMRQQVRENSIELRELEKKLKAAYMNKERAAQ.
Application WB
Background This gene encodes a protein highly similar to the mouse meiosis-specific nuclear structural 1 protein. The mouse protein was shown to be expressed at the pachytene stage during spermatogenesis and may function as a nuclear skeletal protein to regulate nuclear morphology during meiosis.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for MNS1 (1 products)

Catalog No. Species Pres. Purity   Source  

MNS1 (full length, N-term HIS tag)

MNS1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

Positive controls for MNS1 (1 products)

Catalog No. Species Pres. Purity   Source  

MNS1 Lysate

Western Blot: MNS1 Lysate [NBL1-13166] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for MNS1.
  Novus Biologicals Inc.
  • LinkedIn