TA342444 MORF4 antibody

Rabbit Polyclonal Anti-MORF4 Antibody

See related secondary antibodies

Search for all "MORF4"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MORF4

Product Description for MORF4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MORF4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MORF4

Product Category Primary Antibodies
Quantity 50 µg
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

The immunogen for anti-MORF4 antibody: synthetic peptide directed towards the middle region of human MORF4. Synthetic peptide located within the following region: LAYTPLNEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVALPEYHRKAV.
Application WB
Background Cellular senescence, the termil nondividing state that normal cells enter following completion of their proliferative potential, is the domint phenotype in hybrids of normal and immortal cells. Fusions of immortal human cell lines with each other have led to their assignment to 1 of several complementation groups. MORF4 is a gene on chromosome 4 that induces a senescent-like phenotype in cell lines assigned to complementation group B.Cellular senescence, the termil nondividing state that normal cells enter following completion of their proliferative potential, is the domint phenotype in hybrids of normal and immortal cells. Fusions of immortal human cell lines with each other have led to their assignment to 1 of several complementation groups. MORF4 is a gene on chromosome 4 that induces a senescent-like phenotype in cell lines assigned to complementation group B.[supplied by OMIM].
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 191% sucrose.

Accessory Products

  • LinkedIn