H00010933-M01 MORF4L1 antibody

See related secondary antibodies

Search for all "MORF4L1"

0.1 mg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human MORF4L1 6B6

H00010933-M01

Product Description for MORF4L1

Mouse anti Human MORF4L1 6B6.
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for MORF4L1

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms Eaf3, FWP006, HsT17725, MGC10631, MORFRG15, MRG15, S863-6
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 6B6
Host Mouse
Isotype IgG2a
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86YT7
Immunogen:
MORF4L1 (NP_006782.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQREL QKANQEQYAEGKMRGAAPGKKTSG
GeneID:
10933
Add. information Mouse monoclonal antibody raised against a partial recombinant MORF4L1.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody Reactive Against Recombinant Protein.

Accessory Products

  • LinkedIn