discontinued

H00010198-A01 MPHOSPH9 antibody

See related secondary antibodies

Search for all "MPHOSPH9"

Quick Overview

Mouse anti Human MPHOSPH9

Product Description for MPHOSPH9

Mouse anti Human MPHOSPH9.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for MPHOSPH9

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms M-phase phosphoprotein 9, MPP9
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99550
Immunogen:
MPHOSPH9 (NP_073619, 922 a.a. ~ 1032 a.a) partial recombinant protein with GST tag.
AA Sequence:
SVRTAWEKNKSVSYEQCKPVSVTPQGNDFEYTAKIRTLAETERFFDELTKEKDQIEAALSRMPSPGGRITLQTRLN QEALEDRLERINRELGSVRMTLKKFHVLRTSANL*
GeneID:
10198
Remarks:
Gene Accession: NM_022782
Add. information Mouse polyclonal antibody raised against a partial recombinant MPHOSPH9.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 10198

Accessory Products

Proteins and/or Positive Controls

Proteins for MPHOSPH9 (4 products)

Catalog No. Species Pres. Purity   Source  

MPHOSPH9

MPHOSPH9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MPHOSPH9

MPHOSPH9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MPHOSPH9

MPHOSPH9 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MPHOSPH9

MPHOSPH9 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MPHOSPH9 (2 products)

Catalog No. Species Pres. Purity   Source  

MPHOSPH9 293T Cell Transient Overexpression Lysate(Denatured)

MPHOSPH9 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MPHOSPH9 overexpression lysate

MPHOSPH9 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn