discontinued

H00010198-M10 MPHOSPH9 antibody

See related secondary antibodies

Search for all "MPHOSPH9"

Quick Overview

Mouse anti Human MPHOSPH9 4E10

H00010198-M10

More Views

  • H00010198-M10

Product Description for MPHOSPH9

Mouse anti Human MPHOSPH9 4E10.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for MPHOSPH9

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms M-phase phosphoprotein 9, MPP9
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 4E10
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99550
Immunogen:
MPHOSPH9 (NP_073619, 922 a.a. ~ 1032 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
SVRTAWEKNKSVSYEQCKPVSVTPQGNDFEYTAKIRTLAETERFFDELTKEKDQIEAALSRMPSPGGRITLQTRLN QEALEDRLERINRELGSVRMTLKKFHVLRTSANL*
GeneID:
10198
Remarks:
Gene Accession: NM_022782
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant MPHOSPH9.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10198

Accessory Products

Proteins and/or Positive Controls

Proteins for MPHOSPH9 (4 products)

Catalog No. Species Pres. Purity   Source  

MPHOSPH9

MPHOSPH9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MPHOSPH9

MPHOSPH9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MPHOSPH9

MPHOSPH9 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MPHOSPH9

MPHOSPH9 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MPHOSPH9 (2 products)

Catalog No. Species Pres. Purity   Source  

MPHOSPH9 293T Cell Transient Overexpression Lysate(Denatured)

MPHOSPH9 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MPHOSPH9 overexpression lysate

MPHOSPH9 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn