discontinued

H00000758-B01P MPPED1 antibody

See related secondary antibodies

Search for all "MPPED1"

Quick Overview

Mouse anti Human MPPED1

Product Description for MPPED1

Mouse anti Human MPPED1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for MPPED1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 239AB, Adult brain protein 239, C22orf1, FAM1A
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O15442
Immunogen:
MPPED1 (AAH28035, 1 a.a. ~ 327 a.a) full-length human protein.
AA Sequence:
MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQPPHVQMV DPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPYEYKIVIAGNHEL TFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQAL LEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASV CTVNYQPVNPPIVIDLPTPRNS*
GeneID:
758
Remarks:
Gene Accession: BC028035
Add. information Mouse polyclonal antibody raised against a full-length human MPPED1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 758

Accessory Products

Proteins and/or Positive Controls

Proteins for MPPED1 (4 products)

Catalog No. Species Pres. Purity   Source  

MPPED1

MPPED1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MPPED1

MPPED1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MPPED1

MPPED1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MPPED1

MPPED1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MPPED1 (4 products)

Catalog No. Species Pres. Purity   Source  

MPPED1 293T Cell Transient Overexpression Lysate(Denatured)

MPPED1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MPPED1 293T Cell Transient Overexpression Lysate(Denatured)

MPPED1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MPPED1 Lysate

Western Blot: MPPED1 Lysate [NBL1-13207] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MPPED1
  Novus Biologicals Inc.

MPPED1 overexpression lysate

MPPED1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn