discontinued

H00079922-B01 MRM1 antibody

See related secondary antibodies

Search for all "MRM1"

Quick Overview

Mouse anti Human MRM1

Product Description for MRM1

Mouse anti Human MRM1.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for MRM1

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Mitochondrial large ribosomal RNA ribose methylase, mitochondrial, rRNA methyltransferase 1
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6IN84
Immunogen:
MRM1 (NP_079140, 1 a.a. ~ 353 a.a) full-length human protein.
AA Sequence:
MALLSTVRGATWGRLVTRHFSHAARHGERPGGEELSRLLLDDLVPTSRLELLFGMTPCLLALQAARRSVARLLLQA GKAGLQGKRAELLRMAEARDIPVLRPRRQKLDTMCRYQVHQGVCMEVSPLRPRPWREAGEASPGDDPQQLWLVLDG IQDPRNFGAVLRSAHFLGVDKVITSRRNSCPLTPVVSKSSAGAMEVMDVFSTDDLTGFLQTKAQQGWLVAGTVGCP STEDPQSSEIPIMSCLEFLWERPTLLVLGNEGSGLSQEVQASCQLLLTILPRRQLPPGLESLNVSVAAGILLHSIC SQRKGFPTEGERRQLLQDPQEPSARSEGLSMAQHPGLSSGPEKERQNEG
GeneID:
79922
Remarks:
Gene Accession: NM_024864
Add. information Mouse polyclonal antibody raised against a full-length human MRM1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 79922

Accessory Products

Proteins and/or Positive Controls

Proteins for MRM1 (5 products)

Catalog No. Species Pres. Purity   Source  

MRM1

MRM1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

MRM1 (21-353, His-tag)

MRM1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €940.00
  Acris Antibodies GmbH

MRM1 (21-353, His-tag)

MRM1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €370.00
  Acris Antibodies GmbH

MRM1

MRM1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MRM1

MRM1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for MRM1 (3 products)

Catalog No. Species Pres. Purity   Source  

MRM1 293T Cell Transient Overexpression Lysate(Denatured)

MRM1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MRM1 Lysate

Western Blot: MRM1 Lysate [NBL1-13230] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MRM1
  Novus Biologicals Inc.

MRM1 overexpression lysate

MRM1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn