discontinued

NBP1-74139 MRPL21 antibody

See related secondary antibodies

Search for all "MRPL21"

50 µg / €390.00

Quick Overview

Rabbit anti Mouse MRPL21

NBP1-74139

Product Description for MRPL21

Rabbit anti Mouse MRPL21.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for MRPL21

Product Category Primary Antibodies
Quantity 50 µg
Synonyms L21mt, MRP-L21
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A8Y5G2
Immunogen:
Synthetic peptides corresponding to the middle region of Mrpl21. Immunizing peptide sequence LPDPVEETRHHAEVVKRVNELIATGQYGRLFAVVHFASHQWKVTAEDLIL.
GeneID:
353242
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
State:
Aff - Purified
Gene ID 353242

Accessory Products

  • LinkedIn