NBP1-91042 MRPL55 antibody

See related secondary antibodies

Search for all "MRPL55"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MRPL55

Product Description for MRPL55

Rabbit anti Human MRPL55.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for MRPL55

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z7F7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK
GeneID:
128308
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 128308

Accessory Products

Proteins and/or Positive Controls

Positive controls for MRPL55 (1 products)

Catalog No. Species Pres. Purity   Source  

MRPL55 overexpression lysate

MRPL55 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn