
NBP1-58154 MSH5 antibody

See related secondary antibodies

Search for all "MSH5"

Quick Overview

Rabbit anti Human MSH5

Product Description for MSH5

Rabbit anti Human MSH5.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for MSH5

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp434C1615, G7, MGC2939, MutSH5, NG23
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to MSH5(mutS homolog 5 (E. coli)) The peptide sequence was selected from the N terminal of MSH5. Peptide sequence KQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTPPGDLRFTPIPLLI.
Background MSH5 is a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over. This protein forms heterooligomers with another member of this family, mutS homolog 4.This gene encodes a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over. This protein forms heterooligomers with another member of this family, mutS homolog 4. Alternative splicing results in four transcript variants encoding three different isoforms.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn