PAB22573 MUC17 antibody

See related secondary antibodies

Search for all "MUC17"

0.1 ml / €470.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MUC17

Product Description for MUC17

Rabbit anti Human MUC17.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for MUC17

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MUC-17, MUC-3, MUC17, MUC3, Mucin-17, Small intestinal mucin-3
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q685J3
Immunogen:
Recombinant protein corresponding to amino acids of human MUC17.
AA Sequence:
NPTSTPTVPRTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSV KFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYK
GeneID:
140453
Application Immunohistochemistry (1:20-1:50). 
For HIER pH6 retrieval is recommended.
Background Membrane mucins, such as MUC17, function in epithelial cells to provide cytoprotection, maintain luminal structure, provide signal transduction, and confer antiadhesive properties upon cancer cells that lose their apical/basal polarization.[supplied by OMIM]
Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Format
Purification:
Antigen affinity purification
Buffer System:
PBS, pH 7.2, containing 40% glycerol
Preservatives:
0.02% Sodium Azide
State:
Liquid
Aff - Purified

Accessory Products

  • LinkedIn