discontinued

H00394263-B01P MUC21 antibody

See related secondary antibodies

Search for all "MUC21"

Quick Overview

Mouse anti Human MUC21

H00394263-B01P

Product Description for MUC21

Mouse anti Human MUC21.
Product is tested for Western blot / Immunoblot.

Properties for MUC21

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C6orf205, KMQK697, MGC125609, bCX31G15.2
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5SSG8
Immunogen:
MUC21 (NP_001010909.1, 1 a.a. ~ 566 a.a) full-length human protein.
AA Sequence:
MKMQKGNVLLMFGLLLHLEAATNSNETSTSANTGSSVISSGASTATNSGSSVTSSGVSTATISGSSVTSNGVSIVT NSEFHTTSSGISTATNSEFSTASSGISIATNSESSTTSSGASTATNSESSTPSSGASTATNSDSSTTSSGASTATN SDSSTTSSEASTATNSESSTTSSGASTATNSESSTVSSRASTATNSESSTTSSGASTATNSESRTTSNGAGTATNS ESSTTSSGASTATNSESSTPSSGAGTATNSESSTTSSGAGTATNSESSTVSSGISTVTNSESSTPSSGANTATNSE SSTTSSGANTATNSDSSTTSSGASTATNSESSTTSSGASTATNSESSTTSSGASTATNSGSSTTSSGTSTATNSES STVSSGASTATTSESSTTSSGASTATNSESSTVSSGASTATNSESSTTSSGANTATNSGSSVTSAGSGTAALTGMH TTSHSASTAVSEAKPGGSLVPWEIFLITLVSVVAAVGLFAGLFFCVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGG NHGAPHRPRWSPNWFWRRPVSSIAMEMSGRNSGP
GeneID:
394263
Add. information Mouse polyclonal antibody raised against a full-length human MUC21 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn