discontinued

NBP1-70643 MUC3 antibody

See related secondary antibodies

Search for all "MUC3"

50 µg / €380.00

Quick Overview

Rabbit anti Human MUC3

Product Description for MUC3

Rabbit anti Human MUC3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for MUC3

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A9L978
Immunogen:
Synthetic peptides corresponding to MUC3B(mucin 3B, cell surface associated) The peptide sequence was selected from the N terminal of MUC3B. Peptide sequence KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI.
GeneID:
5787601
Background MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 5787601

Accessory Products

  • LinkedIn