discontinued

NBP1-55284 MURF2 antibody

See related secondary antibodies

Search for all "MURF2"

50 µg / €390.00

Quick Overview

Rabbit anti Human, Mouse, Rat MURF2

Product Description for MURF2

Rabbit anti Human, Mouse, Rat MURF2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for MURF2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B3KRC0
Immunogen:
Synthetic peptides corresponding to TRIM55(tripartite motif-containing 55) The peptide sequence was selected from the N terminal of TRIM55. Peptide sequence SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ.
GeneID:
84675
Background TRIM55 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres.The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres. Four alternatively spliced transcript variants encoding distinct isoforms have been described.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 84675

Accessory Products

  • LinkedIn