discontinued

H00004608-D01P MYBPH antibody

See related secondary antibodies

Search for all "MYBPH"

Quick Overview

Rabbit anti Human MYBPH

Product Description for MYBPH

Rabbit anti Human MYBPH.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for MYBPH

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms H-protein, Myosin-binding protein H
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13203
Immunogen:
MYBPH (NP_004988.2, 1 a.a. ~ 477 a.a) full-length human protein.
AA Sequence:
MMEKNTSEGPACSPEETASESAKVPTAEPPGEVAVSESTREEQVPKPQAPAPQAPTASTATKPAPPSEDVPSAPLL LTLDDVSSSSVTVSWEPPERLGRLGLQGYVLELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAG AGPPAMLDQPIHIRENIEAPKIRVPRHLRQTYIRQVGETVNLQIPFQGKPKPQATWTHNGHALDSQRVSMRTGDQD SILFIRSAQRSDSGRYELTVRVEDLEAKAVIDILVIEKPGPPSSIRLLDVWGCNAALQWTPPQDTGNTELLGYMVQ KADKKTGQWFTVLERYHPTTCTISDLIIGNSYSFRVFSENLCGLSTSATVTKELAHIQKADIAAKPKGFIERDFSE APSFTQPLADHTSTPGYSTQLFCSVRASPKPKIIWMKNKMEIQGNPKYRALSEQGVCTLEIRKPSPFDSGVYTCKA INVLGEASVDCRLEVKASAAH
GeneID:
4608
Remarks:
Gene Accession: NM_004997.2
Add. information Rabbit polyclonal antibody raised against a full-length human MYBPH protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 4608

Accessory Products

Proteins and/or Positive Controls

Proteins for MYBPH (3 products)

Catalog No. Species Pres. Purity   Source  

MYBPH

MYBPH Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

MYBPH

MYBPH Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MYBPH

MYBPH Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MYBPH (2 products)

Catalog No. Species Pres. Purity   Source  

MYBPH 293T Cell Transient Overexpression Lysate(Denatured)

MYBPH 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MYBPH Lysate

Western Blot: MYBPH Lysate [NBL1-13413] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MYBPH
  Novus Biologicals Inc.
  • LinkedIn