TA342226 MYBPH antibody

Rabbit polyclonal Anti-MYBPH Antibody

See related secondary antibodies

Search for all "MYBPH"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MYBPH

Product Description for MYBPH

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MYBPH.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MYBPH

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms H-protein, Myosin-binding protein H
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-MYBPH antibody: synthetic peptide directed towards the middle region of human MYBPH. Synthetic peptide located within the following region: APKIRVPRHLRQTYIRQVGETVNLQIPFQGKPKPQATWTHNGHALDSQRV.
Application WB
Background Binds to myosin; probably involved in interaction with thick myofilaments inThe A-band.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for MYBPH (3 products)

Catalog No. Species Pres. Purity   Source  


MYBPH Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.


MYBPH Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


MYBPH Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MYBPH (2 products)

Catalog No. Species Pres. Purity   Source  

MYBPH 293T Cell Transient Overexpression Lysate(Denatured)

MYBPH 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MYBPH Lysate

Western Blot: MYBPH Lysate [NBL1-13413] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MYBPH
  Novus Biologicals Inc.
  • LinkedIn