H00150678-B01P MYEOV2 antibody

See related secondary antibodies

Search for all "MYEOV2"

50 µg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human MYEOV2

H00150678-B01P

Product Description for MYEOV2

Mouse anti Human MYEOV2.
Product is tested for Western blot / Immunoblot.

Properties for MYEOV2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms -
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WXC6
Immunogen:
MYEOV2 (NP_612209.1, 1 a.a. ~ 252 a.a) full-length human protein.
AA Sequence:
MWRAPEAALRPEVSLERRGPEMKPAVDEMFPEGAGPYVDLDEVARARRESPSAGGSTGLLMDLAANEKAVHADFFN DFEDLFDDDDIHSSGLPRTSQQSSMVPALQRGQSEHGVRGKAAERPVVSEERCELNGREVAALDRAFGSTGHGQGA EALMFTRCREHPLCGTNKATSEGKMGTGRLRNSLRKNQSKWLGSYLEVLRTTRSRREVSEDSTISVSTHWRGKCFK SDETPSVAGGEEGKKTTQPCIDVR
GeneID:
150678
Add. information Mouse polyclonal antibody raised against a full-length human MYEOV2 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn