
NBP1-74113 Myocardin antibody

See related secondary antibodies

Search for all "Myocardin"

Quick Overview

Rabbit anti Mouse Myocardin


Product Description for Myocardin

Rabbit anti Mouse Myocardin.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Myocardin

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to the N terminal of Myocd. Immunizing peptide sequence KSLGDSKNRHKKPKDPKPKVKKLKYHQYIPPDQKAEKSPPPMDSAYARLL.
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
Aff - Purified

Accessory Products

  • LinkedIn