discontinued

H00004642-B01P Myosin-Id antibody

See related secondary antibodies

Search for all "Myosin-Id"

Quick Overview

Mouse anti Human Myosin-Id

Product Description for Myosin-Id

Mouse anti Human Myosin-Id.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Myosin-Id

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms KIAA0727, MYO1D
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O94832
Immunogen:
MYO1D (AAH30602.1, 1 a.a. ~ 436 a.a) full-length human protein.
AA Sequence:
MAEQESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKLLNIYGRDTIEQYKGRELYERPP HLFAIADAAYKAMKRRSKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAK TNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLRSLHLQKSLSSY NYIHVGAQLKSSINDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNLKFVVDGDTPLIENGKVVSIIAELL STKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTRINDIIEVKNYDTTIHGKNTVIG VLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHVGLL
GeneID:
4642
Remarks:
Gene Accession: BC030602.2
Add. information Mouse polyclonal antibody raised against a full-length human MYO1D protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 4642

Accessory Products

Proteins and/or Positive Controls

Proteins for Myosin-Id (4 products)

Catalog No. Species Pres. Purity   Source  

Myosin-Id

Myosin-Id Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Myosin-Id

Myosin-Id Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Myosin-Id

Myosin-Id Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Myosin-Id

Myosin-Id Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Myosin-Id (1 products)

Catalog No. Species Pres. Purity   Source  

MYO1D 293T Cell Transient Overexpression Lysate(Denatured)

MYO1D 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn