NBP1-56405 Myosin light chain 3 antibody

See related secondary antibodies

Search for all "Myosin light chain 3"

Quick Overview

Rabbit anti Human, Mouse, Rat Myosin light chain 3

Product Description for Myosin light chain 3

Rabbit anti Human, Mouse, Rat Myosin light chain 3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Myosin light chain 3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CMH8, MLC1V, VLC1
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to MYL3(myosin, light chain 3, alkali; ventricular, skeletal, slow) The peptide sequence was selected from the N terminal of MYL3. Peptide sequence VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG.
Background MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypert
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 100174572

Accessory Products

  • LinkedIn