discontinued

H00055728-A01 N4BP2 antibody

See related secondary antibodies

Search for all "N4BP2"

Quick Overview

Mouse anti Human N4BP2

Product Description for N4BP2

Mouse anti Human N4BP2.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for N4BP2

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms B3BP, BCL-3-binding protein, KIAA1413, NEDD4-binding protein 2
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86UW6
Immunogen:
N4BP2 (NP_060647, 1671 a.a. ~ 1771 a.a) partial recombinant protein with GST tag.
AA Sequence:
HLAAIEIFEKVNASLLPQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAV IKYLISHSFRFSEIKPGCLKVMLK*
GeneID:
55728
Remarks:
Gene Accession: NM_018177
Add. information Mouse polyclonal antibody raised against a partial recombinant N4BP2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 55728

Accessory Products

Proteins and/or Positive Controls

Proteins for N4BP2 (2 products)

Catalog No. Species Pres. Purity   Source  

N4BP2

N4BP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

N4BP2

N4BP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn