discontinued

H00055728-M01 N4BP2 antibody

See related secondary antibodies

Search for all "N4BP2"

Quick Overview

Mouse anti Human N4BP2 2H5

Product Description for N4BP2

Mouse anti Human N4BP2 2H5.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for N4BP2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms B3BP, BCL-3-binding protein, KIAA1413, NEDD4-binding protein 2
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2H5
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86UW6
Immunogen:
N4BP2 (NP_060647, 1671 a.a. ~ 1771 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
HLAAIEIFEKVNASLLPQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAV IKYLISHSFRFSEIKPGCLKVMLK*
GeneID:
55728
Remarks:
Gene Accession: NM_018177
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant N4BP2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 55728

Accessory Products

Proteins and/or Positive Controls

Proteins for N4BP2 (2 products)

Catalog No. Species Pres. Purity   Source  

N4BP2

N4BP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

N4BP2

N4BP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn