H00029104-D01P N6AMT1 purified MaxPab rabbit antibody

See related secondary antibodies

Search for all "N6AMT1 purified MaxPab rabbit"

0.1 mg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human N6AMT1 purified MaxPab rabbit

Product Description for N6AMT1 purified MaxPab rabbit

Rabbit anti Human N6AMT1 purified MaxPab rabbit.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for N6AMT1 purified MaxPab rabbit

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms C21orf127, HEMK2, MGC19995, MTQ2, N-6 adenine-specific DNA methyltransferase 1, N6AMT, PRED28, putative
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
N6AMT1 (AAH11554.1, 1 a.a. ~ 186 a.a) full-length human protein.
AA Sequence:
MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCT DINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPE EILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
Remarks:
Gene Accession: BC011554.1
Add. information Rabbit polyclonal antibody raised against a full-length human N6AMT1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn