discontinued

H00342538-B01P NACA2 antibody

See related secondary antibodies

Search for all "NACA2"

Quick Overview

Mouse anti Human NACA2

H00342538-B01P

More Views

  • H00342538-B01P

Product Description for NACA2

Mouse anti Human NACA2.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for NACA2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Alpha-NAC-like, NACAL, Nascent polypeptide-associated complex subunit alpha-2
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H009
Immunogen:
NACAL (NP_954984.1, 1 a.a. ~ 215 a.a) full-length human protein.
AA Sequence:
MPGEATETVPATEQELPQSQAETGSGTASDSGESVPGIEEQDSTQTTTQKAWLVAAAEIDEEPVGKAKQSRSEKRA RKAMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAYIVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGN IQENTQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV
GeneID:
342538
Remarks:
Gene Accession: NM_199290.2
Add. information Mouse polyclonal antibody raised against a full-length human NACAL protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 342538

Accessory Products

Proteins and/or Positive Controls

Proteins for NACA2 (4 products)

Catalog No. Species Pres. Purity   Source  

NACA2

NACA2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NACA2

NACA2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NACA2

NACA2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NACA2

NACA2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NACA2 (3 products)

Catalog No. Species Pres. Purity   Source  

NACA2 Lysate

Western Blot: NACA2 Lysate [NBL1-13455] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NACA2
  Novus Biologicals Inc.

NACA2 overexpression lysate

NACA2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

NACAL 293T Cell Transient Overexpression Lysate(Denatured)

NACAL 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn