discontinued

H00004674-B01P NAP1L2 / BPX antibody

See related secondary antibodies

Search for all "NAP1L2 / BPX"

Quick Overview

Mouse anti Human NAP1L2 / BPX

H00004674-B01P

More Views

  • H00004674-B01P

Product Description for NAP1L2 / BPX

Mouse anti Human NAP1L2 / BPX.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for NAP1L2 / BPX

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Brain-specific protein X-linked, Nucleosome assembly protein 1-like 2
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9ULW6
Immunogen:
NAP1L2 (AAH26325.1, 1 a.a. ~ 460 a.a) full-length human protein.
AA Sequence:
MAKSENRKELSESSQEEAGNQIMVEGLGEHLERGEDAAAGLGDDGKCGEEAAAGLGEEGENGEDTAAGSGEDGKKG GDTDEDSEADRPKGLIGYVLDTDFVESLPVKVKYRVLALKKLQTRAANLESKFLREFHDIERKFAEMYQPLLEKRR QIINAIYEPTEEECEYKSDSEDCDDEEMCHEEMYGNEEGMVHEYVDEDDGYEDYYYDYAVEEEEEEEEEDDIEATG EENKEEEDPKGIPDFWLTVLKNVDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNELLTK TYVLKSKLAYYDPHPYRGTAIEYSTGCEIDWNEGKNVTLKTIKKKQKHRIWGTIRTVTEDFPKDSFFNFFSPHGIT SNGRDGNDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGVVREVNDAIYDKIIYDNWMAAIEEVKACCKNLEALVE DIDR
GeneID:
4674
Remarks:
Gene Accession: BC026325.1
Add. information Mouse polyclonal antibody raised against a full-length human NAP1L2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 4674

Accessory Products

Proteins and/or Positive Controls

Proteins for NAP1L2 / BPX (6 products)

Catalog No. Species Pres. Purity   Source  

NAP1L2 / BPX

NAP1L2 / BPX Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

NAP1L2 / BPX

NAP1L2 / BPX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NAP1L2 / BPX

NAP1L2 / BPX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NAP1L2 / BPX

NAP1L2 / BPX Human Purified
  Abnova Taiwan Corp.

NAP1L2 / BPX

NAP1L2 / BPX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NAP1L2 / BPX

NAP1L2 / BPX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for NAP1L2 / BPX (2 products)

Catalog No. Species Pres. Purity   Source  

NAP1L2 293T Cell Transient Overexpression Lysate(Denatured)

NAP1L2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NAP1L2 overexpression lysate

NAP1L2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn