TA344712 NAP1L2 / BPX antibody

Rabbit Polyclonal Anti-NAP1L2 Antibody - middle region

See related secondary antibodies

Search for all "NAP1L2 / BPX"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Rabbit, Rat NAP1L2 / BPX

Product Description for NAP1L2 / BPX

Rabbit anti Canine, Equine, Human, Rabbit, Rat NAP1L2 / BPX.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NAP1L2 / BPX

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Brain-specific protein X-linked, Nucleosome assembly protein 1-like 2
Presentation Purified
Reactivity Can, Eq, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9ULW6
Immunogen:
The immunogen for anti-NAP1L2 antibody: synthetic peptide directed towards the middle region of human NAP1L2. Synthetic peptide located within the following region: VDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNE.
GeneID:
4674
Application WB
Background This gene encodes a member of the nucleosome assembly protein (P) family. The function of this family member is unknown; however, mouse studies suggest that it represents a class of tissue-specific factors interacting with chromatin to regulate neurol cell proliferation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NAP1L2 / BPX (6 products)

Catalog No. Species Pres. Purity   Source  

NAP1L2 / BPX

NAP1L2 / BPX Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NAP1L2 / BPX

NAP1L2 / BPX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NAP1L2 / BPX

NAP1L2 / BPX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NAP1L2 / BPX

NAP1L2 / BPX Human Purified
  Abnova Taiwan Corp.

NAP1L2 / BPX

NAP1L2 / BPX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NAP1L2 / BPX

NAP1L2 / BPX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for NAP1L2 / BPX (2 products)

Catalog No. Species Pres. Purity   Source  

NAP1L2 293T Cell Transient Overexpression Lysate(Denatured)

NAP1L2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NAP1L2 overexpression lysate

NAP1L2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn