NBP1-53124 NARG1L antibody

See related secondary antibodies

Search for all "NARG1L"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat NARG1L

Product Description for NARG1L

Rabbit anti Human, Mouse, Rat NARG1L.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for NARG1L

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC40612, RP11-396A22.1
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to NARG1L(NMDA receptor regulated 1-like) The peptide sequence was selected from the middle region of NARG1L. Peptide sequence ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA.
Background NARG1L may belong to a complex displaying N-terminal acetyltransferase activity.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 79612

Accessory Products

  • LinkedIn