
NBP1-53124 NARG1L antibody

See related secondary antibodies

Search for all "NARG1L"

Quick Overview

Rabbit anti Human, Mouse, Rat NARG1L

Product Description for NARG1L

Rabbit anti Human, Mouse, Rat NARG1L.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for NARG1L

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC40612, RP11-396A22.1
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to NARG1L(NMDA receptor regulated 1-like) The peptide sequence was selected from the middle region of NARG1L. Peptide sequence ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA.
Background NARG1L may belong to a complex displaying N-terminal acetyltransferase activity.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 79612

Accessory Products

  • LinkedIn