NBP1-52914 NASP antibody

See related secondary antibodies

Search for all "NASP"

Quick Overview

Rabbit anti Human, Mouse, Rat NASP

Product Description for NASP

Rabbit anti Human, Mouse, Rat NASP.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for NASP

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp547F162, FLB7527, FLJ31599, FLJ35510, MGC19722, MGC20372, MGC2297, PRO1999
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to NASP(nuclear autoantigenic sperm protein (histone-binding)) The peptide sequence was selected from the middle region of NASP. Peptide sequence KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV.
Background This gene encodes a H1 histone binding protein that is involved in transporting histones into the nucleus of dividing cells. Multiple isoforms are encoded by transcript variants of this gene. The somatic form is expressed in all mitotic cells, is localize
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 4678

Accessory Products

  • LinkedIn