H00004681-D01P NBL1 antibody

See related secondary antibodies

Search for all "NBL1"

0.1 mg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse NBL1

H00004681-D01P

More Views

  • H00004681-D01P
  • H00004681-D01P

Product Description for NBL1

Rabbit anti Human, Mouse NBL1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for NBL1

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms DAN, DAND1, Neuroblastoma suppressor of tumorigenicity 1
Presentation Purified
Reactivity Hu, Ms
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
M1S623
Immunogen:
NBL1 (NP_005371.1, 1 a.a. ~ 180 a.a) full-length human protein.
AA Sequence:
MLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTE SLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPH PHPHPGGQTPEPEDPPGAPHTEEEGAED
GeneID:
5460
Remarks:
Gene Accession: NM_005380
Add. information Rabbit polyclonal antibody raised against a full-length human NBL1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse
Gene ID 4681

Accessory Products

Proteins and/or Positive Controls

Proteins for NBL1 (9 products)

Catalog No. Species Pres. Purity   Source  

NBL1 (18-181, His-tag)

NBL1 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

NBL1 (18-181, His-tag)

NBL1 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

NBL1

NBL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
10 µg / €380.00
  Abnova Taiwan Corp.

NBL1

NBL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
25 µg / €510.00
  Abnova Taiwan Corp.

NBL1

NBL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
10 µg / €380.00
  Abnova Taiwan Corp.

NBL1

NBL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
25 µg / €510.00
  Abnova Taiwan Corp.

OCT4 (1-265, His-tag)

OCT4 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €940.00
  Acris Antibodies GmbH

OCT4 (1-265, His-tag)

OCT4 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €370.00
  Acris Antibodies GmbH

POU class 5 homeobox 1 (POU5F1/OCT4), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug (full length, N-term HIS tag, transcript variant 2)

POU class 5 homeobox 1 (POU5F1/OCT4), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Positive controls for NBL1 (2 products)

Catalog No. Species Pres. Purity   Source  

NBL1 Lysate

Western Blot: NBL1 Lysate [NBL1-13496] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for NBL1.
0.1 mg / €400.00
  Novus Biologicals Inc.

POU5F1 overexpression lysate

POU5F1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn