TA337465 NBPF11 antibody

Rabbit Polyclonal Anti-NBPF11 Antibody

See related secondary antibodies

Search for all "NBPF11"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Porcine NBPF11

Product Description for NBPF11

Rabbit anti Canine, Human, Porcine NBPF11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NBPF11

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms NBPF24, Neuroblastoma breakpoint family member 11, Neuroblastoma breakpoint family member 24
Presentation Purified
Reactivity Can, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86T75
Immunogen:
The immunogen for Anti-NBPF24 antibody is: synthetic peptide directed towards the C-terminal region of Human NBPF24. Synthetic peptide located within the following region: KAEEKEVPEDSLEECAITCSNSHGPYDSNQPHRKTKITFEEDKVDSTLIG.
GeneID:
200030
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn