H00285622-B01P NBPF22P antibody

See related secondary antibodies

Search for all "NBPF22P"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human NBPF22P

H00285622-B01P

Product Description for NBPF22P

Mouse anti Human NBPF22P.
Product is tested for Western blot / Immunoblot.

Properties for NBPF22P

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC48637
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
NBPF22P (AAH50328.2, 1 a.a. ~ 290 a.a) full-length human protein.
AA Sequence:
MVVSADPLSSERAEMNILEINQELRSQLAESNQQFRDLKEKFLISQATAYSLANQLKKYKKQNDLEEVKGQETVAP RLSRGPLRVDKYEIPQESLDGCCLTPSILPDLTPSYHPYWSTLYSFEDKQVSLALVDKIKKDQEEVEDQSPPCPRL SQERPEVKEQEVPEDSVNEVYLTPSVHHDVSDCHQPYSSTLSSLEDQLACSALDVASPTEAACPQGTWSGDLSHHR SEVQISQAQLEPSTLVPNCLRLQLDQGFHCGNGLPQRGLSSMTRSFSANADSGDEEPSPAGR
GeneID:
285622
Add. information Mouse polyclonal antibody raised against a full-length human NBPF22P protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn