H00400818-B01P NBPF9 antibody

See related secondary antibodies

Search for all "NBPF9"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human NBPF9

H00400818-B01P

Product Description for NBPF9

Mouse anti Human NBPF9.
Product is tested for Western blot / Immunoblot.

Properties for NBPF9

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms KIAA1245, NBPF10
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3BBV1
Immunogen:
NBPF9 (AAI67783.1, 1 a.a. ~ 942 a.a) full-length human protein.
AA Sequence:
MVVSAGPWSSEKAEMNILEINEKLRPQLAENKQQFGNLKERCFLTQLAGFLANRQKKYKYEECKDLIKFMLRNERQ FKEEKLAEQLKQAEELRQYKVLVHSQERELTQLKEKLREGRDASRSLNEHLQALLTPDEPDKSQGQDLQEQLAEGC RLAQHLVQKLSPENDEDEDEDVQVEEDEKVLESPAPREVQKAEESKVTEDSLEECAITCSNSHGPCDSNQPHKNIK ITFEEDEVNSTLVVDRESSHDECQDALNILPVPGPTSSATNVSMVVSAGPLSSEKAEMNILEINEKLRPQLAEKKQ QFRNLKEKCFLTQLAGFLANQQNKYKYEECKDLIKFMLRNERQFKEEKLAEQLKQAEELRQYKVLVHAQERELTQL REKLREGRDASRSLNEHLQALLTPDEPDKSQGQDLQEQLAEGCRLAQHLVQKLSPENDNDDNEDVQVEVAEKVQKS SAPREMQKAEEKEVPEDSLEECAITYSNSHGPYDSNQPHRKTKITFEEDKVDSTLIGSSSHVEREDAVHIIPENES DDEEEEEKGPVSPRNLQESEEEEVPQESWDEGYSTPSIPPEMLASYKSYSSTFHSLEEQQVCMAVDIGRHRWDQVK KEDQEATGPRLSRELLDEKGPEVLQDSLYRCYSTPSGCLELTDSCQPYRSAFYVLEQQRVGLAVDMDEIEKYQEVE EDQDPSCPRLSRELLDEKEPEVLQDSLGRWYSTPSGYPELPDLGQPYSSAVYSLEEQYLGLALDLDRIKKDQEEEE DQGPPCPRLSRELLEVVEPEVLQDSLDRCYSTPSSCLEQPDSWQPYGSSFYALEEKHVGFSLDVGEIEKKGKGKKR RGRRSKKERRRGRKEGEEDQNPPCPRLNGVLMEVEEPEVLQDSLDGCYSTPSMYFELPDSFQHYRSVFYSFEEQHI SFALYVDNRFFTLTVTSLHLVFQMEVIFPQ
GeneID:
400818
Add. information Mouse polyclonal antibody raised against a full-length human NBPF9 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn