discontinued

NBP1-70648 NCRNA00114 antibody

See related secondary antibodies

Search for all "NCRNA00114"

Quick Overview

Rabbit anti Human NCRNA00114

Product Description for NCRNA00114

Rabbit anti Human NCRNA00114.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for NCRNA00114

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13LD6
Immunogen:
Synthetic peptides corresponding to NCRNA00114 The peptide sequence was selected from the N terminal of NCRNA00114. Peptide sequence SFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLT.
GeneID:
4008660
Background The specific function of NCRNA00114 is not yet known.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 4008660

Accessory Products

  • LinkedIn